![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
![]() | Protein DC-SIGNR (DC-SIGN related receptor) [69857] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69858] (4 PDB entries) Uniprot Q9NNX6 219-397 |
![]() | Domain d1sl6b_: 1sl6 B: [105713] contains two repeats of neck complexed with ca |
PDB Entry: 1sl6 (more details), 2.25 Å
SCOPe Domain Sequences for d1sl6b_:
Sequence, based on SEQRES records: (download)
>d1sl6b_ d.169.1.1 (B:) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens) [TaxId: 9606]} peksklqeiyqeltqlkaavgelpdqskqqqiyqeltdlktaferlcrhcpkdwtffqgn cyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqtsrsnrfswmglsdlnqegt wqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnrcdvdnywickkpaacfr
>d1sl6b_ d.169.1.1 (B:) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens) [TaxId: 9606]} peksklqeiyqeltqlkqqqiyqeltdlktaferlcrhcpkdwtffqgncyfmsnsqrnw hdsvtacqevraqlvviktaeeqnflqlqtsrsnrfswmglsdlnqegtwqwvdgsplsp sfqrywnsgepnnsgnedcaefsgsgwndnrcdvdnywickkpaacfr
Timeline for d1sl6b_: