Lineage for d1sjmb2 (1sjm B:167-339)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2367152Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2367387Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 2367455Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (31 PDB entries)
    Uniprot P38501
  8. 2367459Domain d1sjmb2: 1sjm B:167-339 [105657]
    complexed with act, cu, no2, trs

Details for d1sjmb2

PDB Entry: 1sjm (more details), 1.4 Å

PDB Description: nitrite bound copper containing nitrite reductase
PDB Compounds: (B:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d1sjmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjmb2 b.6.1.3 (B:167-339) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg

SCOPe Domain Coordinates for d1sjmb2:

Click to download the PDB-style file with coordinates for d1sjmb2.
(The format of our PDB-style files is described here.)

Timeline for d1sjmb2: