Lineage for d1sjma1 (1sjm A:5-166)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species)
  7. Species Alcaligenes faecalis, strain s-6 [TaxId:511] [419326] (31 PDB entries)
    Uniprot P38501
  8. Domain d1sjma1: 1sjm A:5-166 [105654]
    Other proteins in same PDB: d1sjma2, d1sjmb2, d1sjmc2
    complexed with act, cu, no2, trs

Details for d1sjma1

PDB Entry: 1sjm (more details), 1.4 Å

PDB Description: nitrite bound copper containing nitrite reductase
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d1sjma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjma1 b.6.1.3 (A:5-166) Nitrite reductase, NIR, N-terminal domain {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
taaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamaf
ngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrf
katkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgk

SCOPe Domain Coordinates for d1sjma1 are not available.

Timeline for d1sjma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sjma2
View in 3D
Domains from other chains:
(mouse over for more information)
d1sjmb1, d1sjmb2, d1sjmc1, d1sjmc2