![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins) C-terminal domain is beta/alpha-barrel |
![]() | Protein N-acylamino acid racemase [110937] (4 species) |
![]() | Species Amycolatopsis sp. [TaxId:37632] [110938] (4 PDB entries) Uniprot Q44244; similar activity to a remotely related O-succinylbenzoate synthase from E. coli |
![]() | Domain d1sjca2: 1sjc A:1-125 [105625] Other proteins in same PDB: d1sjca1, d1sjcb1, d1sjcc1, d1sjcd1 complexed with mg, smg |
PDB Entry: 1sjc (more details), 2.1 Å
SCOPe Domain Sequences for d1sjca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sjca2 d.54.1.1 (A:1-125) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]} mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa aelgs
Timeline for d1sjca2: