Lineage for d1sjcd2 (1sjc D:1-125)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. Protein N-acylamino acid racemase [110937] (4 species)
  7. Species Amycolatopsis sp. [TaxId:37632] [110938] (4 PDB entries)
    Uniprot Q44244; similar activity to a remotely related O-succinylbenzoate synthase from E. coli
  8. Domain d1sjcd2: 1sjc D:1-125 [105631]
    Other proteins in same PDB: d1sjca1, d1sjcb1, d1sjcc1, d1sjcd1
    complexed with mg, smg

Details for d1sjcd2

PDB Entry: 1sjc (more details), 2.1 Å

PDB Description: x-ray structure of o-succinylbenzoate synthase complexed with N-succinyl methionine
PDB Compounds: (D:) N-acylamino acid racemase

SCOPe Domain Sequences for d1sjcd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjcd2 d.54.1.1 (D:1-125) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]}
mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
aelgs

SCOPe Domain Coordinates for d1sjcd2 are not available.

Timeline for d1sjcd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sjcd1
View in 3D
Domains from other chains:
(mouse over for more information)
d1sjca1, d1sjca2, d1sjcb1, d1sjcb2, d1sjcc1, d1sjcc2