SCOPe 2.01: Domain d1sjaa1: 1sja A:126-368

Lineage for d1sjaa1 (1sja A:126-368)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (13 proteins)

6. Protein N-acylamino acid racemase [110372] (4 species)

7. Species Amycolatopsis sp. [TaxId:37632] [110373] (4 PDB entries)
   Uniprot Q44244 # similar activity to a remotely related O-succinylbenzoate synthase from E. coli

8. Domain d1sjaa1: 1sja A:126-368 [105608]
   Other proteins in same PDB: d1sjaa2, d1sjab2, d1sjac2, d1sjad2
   complexed with ame, mg

Details for d1sjaa1

PDB Entry: 1sja, 2.3 Å

PDB Description: X-ray structure of o-Succinylbenzoate Synthase complexed with N-acetylmethionine

PDB Compounds: (A:) N-acylamino acid racemase

SCOPe Domain Sequences for d1sjaa1:

Sequence; same for both SEQRES and ATOM records:

>d1sjaa1 c.1.11.2 (A:126-368) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]}
vrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerfgddvl
lqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpicldesivsa
raaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcggmietglgraanval
aslpnftlpgdtsasdrfyktditepfvlsgghlpvptgpglgvapipelldevttakvw
igs

Timeline for d1sjaa1:

• d1sjaa1 first appeared in SCOP 1.69
  
• d1sjaa1 appears in SCOP 1.75
  
• d1sjaa1 appears in SCOPe 2.02
  
• d1sjaa1 appears in the current release, SCOPe 2.08