Lineage for d1siwb_ (1siw B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2172289Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2172425Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 protein domains)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 2172554Protein Respiratory nitrate reductase 1 beta chain [102955] (2 species)
  7. 2172559Species Escherichia coli [TaxId:562] [102956] (8 PDB entries)
    Uniprot P11349
  8. 2172566Domain d1siwb_: 1siw B: [105591]
    Other proteins in same PDB: d1siwa1, d1siwa2, d1siwc_
    complexed with 3ph, f3s, gdp, hem, sf4

Details for d1siwb_

PDB Entry: 1siw (more details), 2.2 Å

PDB Description: Crystal structure of the apomolybdo-NarGHI
PDB Compounds: (B:) Respiratory nitrate reductase 1 beta chain

SCOPe Domain Sequences for d1siwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1siwb_ d.58.1.5 (B:) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]}
mkirsqvgmvlnldkcigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe
kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks
qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl
prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk
sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf
ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls
piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet
vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekngcgftf
gdgchgsdtkfnlfnsrridaidvtskt

SCOPe Domain Coordinates for d1siwb_:

Click to download the PDB-style file with coordinates for d1siwb_.
(The format of our PDB-style files is described here.)

Timeline for d1siwb_: