![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
![]() | Superfamily f.21.3: Respiratory nitrate reductase 1 gamma chain [103501] (1 family) ![]() possible link between the two other superfamilies: this subunit corresponds to the gamma subunit of a functionally related Formate dehydrogenase N complex but is structurally closer to the Fumarate reductase subunit FrdC automatically mapped to Pfam PF02665 |
![]() | Family f.21.3.1: Respiratory nitrate reductase 1 gamma chain [103502] (2 proteins) |
![]() | Protein Respiratory nitrate reductase 1 gamma chain [103503] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [103504] (6 PDB entries) Uniprot P11350 |
![]() | Domain d1siwc_: 1siw C: [105592] Other proteins in same PDB: d1siwa1, d1siwa2, d1siwb_ complexed with 3ph, f3s, gdp, hem, sf4 |
PDB Entry: 1siw (more details), 2.2 Å
SCOPe Domain Sequences for d1siwc_:
Sequence, based on SEQRES records: (download)
>d1siwc_ f.21.3.1 (C:) Respiratory nitrate reductase 1 gamma chain {Escherichia coli [TaxId: 562]} mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil gifvghffgmltphwmyeawlpievkqkmamfaggasgvlcliggvlllkrrlfsprvra tttgadililsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgv afifrlhlvlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh
>d1siwc_ f.21.3.1 (C:) Respiratory nitrate reductase 1 gamma chain {Escherichia coli [TaxId: 562]} mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil gifvghffgmltawlpievkqkmamfaggasgvlcliggvlllkrrlfsprvratttgad ililsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgvafifrl hlvlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh
Timeline for d1siwc_: