Lineage for d1sghb_ (1sgh B:)

  1. Root: SCOPe 2.04
  2. 1713148Class j: Peptides [58231] (126 folds)
  3. Fold j.117: Ezrin-radixin-moesin binding phosphoprotein 50 (ebp50) fragments [111538] (1 superfamily)
  4. Superfamily j.117.1: Ezrin-radixin-moesin binding phosphoprotein 50 (ebp50) fragments [111539] (1 family) (S)
  5. Family j.117.1.1: Ezrin-radixin-moesin binding phosphoprotein 50 (ebp50) fragments [111540] (1 protein)
  6. Protein Ezrin-radixin-moesin binding phosphoprotein 50 (ebp50) fragments [111541] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [111542] (1 PDB entry)
    Uniprot O14745 321-358
  8. 1714954Domain d1sghb_: 1sgh B: [105532]
    Other proteins in same PDB: d1sgha1, d1sgha2, d1sgha3

Details for d1sghb_

PDB Entry: 1sgh (more details), 3.5 Å

PDB Description: Moesin FERM domain bound to EBP50 C-terminal peptide
PDB Compounds: (B:) Ezrin-radixin-moesin binding phosphoprotein 50

SCOPe Domain Sequences for d1sghb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sghb_ j.117.1.1 (B:) Ezrin-radixin-moesin binding phosphoprotein 50 (ebp50) fragments {Human (Homo sapiens) [TaxId: 9606]}
ldfnislamakerahqkrsskrapqmdwskknelfsnl

SCOPe Domain Coordinates for d1sghb_:

Click to download the PDB-style file with coordinates for d1sghb_.
(The format of our PDB-style files is described here.)

Timeline for d1sghb_: