SCOPe 2.08: Domain d1sghb_: 1sgh B:

Lineage for d1sghb_ (1sgh B:)

1. Root: SCOPe 2.08

2. Class j: Peptides [58231] (151 folds)

3. Fold j.117: Ezrin-radixin-moesin binding phosphoprotein 50 (ebp50) fragments [111538] (1 superfamily)

4. Superfamily j.117.1: Ezrin-radixin-moesin binding phosphoprotein 50 (ebp50) fragments [111539] (1 family)

5. Family j.117.1.1: Ezrin-radixin-moesin binding phosphoprotein 50 (ebp50) fragments [111540] (1 protein)

6. Protein Ezrin-radixin-moesin binding phosphoprotein 50 (ebp50) fragments [111541] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [111542] (1 PDB entry)
   Uniprot O14745 321-358

8. Domain d1sghb_: 1sgh B: [105532]
   Other proteins in same PDB: d1sgha1, d1sgha2, d1sgha3

Details for d1sghb_

PDB Entry: 1sgh, 3.5 Å

PDB Description: Moesin FERM domain bound to EBP50 C-terminal peptide

PDB Compounds: (B:) Ezrin-radixin-moesin binding phosphoprotein 50

SCOPe Domain Sequences for d1sghb_:

Sequence; same for both SEQRES and ATOM records:

>d1sghb_ j.117.1.1 (B:) Ezrin-radixin-moesin binding phosphoprotein 50 (ebp50) fragments {Human (Homo sapiens) [TaxId: 9606]}
ldfnislamakerahqkrsskrapqmdwskknelfsnl

Timeline for d1sghb_:

• d1sghb_ first appeared in SCOP 1.69
  
• d1sghb_ appears in SCOPe 2.07