Lineage for d1sg1x2 (1sg1 X:57-95)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1462573Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 1462574Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 1462575Family g.24.1.1: TNF receptor-like [57587] (6 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 1462626Protein Low affinity neurotrophin receptor p75NTR [111413] (1 species)
  7. 1462627Species Norway rat (Rattus norvegicus) [TaxId:10116] [111414] (2 PDB entries)
    Uniprot P07174 31-190 # fragment contains 3 complete and 1 partial (C-terminal) 'domains'
  8. 1462629Domain d1sg1x2: 1sg1 X:57-95 [105516]
    Other proteins in same PDB: d1sg1a_, d1sg1b_
    complexed with cl

Details for d1sg1x2

PDB Entry: 1sg1 (more details), 2.4 Å

PDB Description: Crystal Structure of the Receptor-Ligand Complex between Nerve Growth Factor and the Common Neurotrophin Receptor p75
PDB Compounds: (X:) Tumor necrosis factor receptor superfamily member 16

SCOPe Domain Sequences for d1sg1x2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sg1x2 g.24.1.1 (X:57-95) Low affinity neurotrophin receptor p75NTR {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pcteclglqsmsapcveaddavcrcaygyyqdeetghce

SCOPe Domain Coordinates for d1sg1x2:

Click to download the PDB-style file with coordinates for d1sg1x2.
(The format of our PDB-style files is described here.)

Timeline for d1sg1x2: