SCOP 1.69: Domain d1sg1x2: 1sg1 X:57-95

Lineage for d1sg1x2 (1sg1 X:57-95)

1. Root: SCOP 1.69

2. Class g: Small proteins [56992] (75 folds)

3. Fold g.24: TNF receptor-like [57585] (1 superfamily)
   duplication: consists of three similar disulfide-rich domains

4. Superfamily g.24.1: TNF receptor-like [57586] (2 families)

5. Family g.24.1.1: TNF receptor-like [57587] (4 proteins)
   TNFR/NGFR cysteine-rich region (Pfam 00020)

6. Protein Low affinity neurotrophin receptor p75NTR [111413] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [111414] (1 PDB entry)

8. Domain d1sg1x2: 1sg1 X:57-95 [105516]
   Other proteins in same PDB: d1sg1a_, d1sg1b_

Details for d1sg1x2

PDB Entry: 1sg1, 2.4 Å

PDB Description: Crystal Structure of the Receptor-Ligand Complex between Nerve Growth Factor and the Common Neurotrophin Receptor p75

SCOP Domain Sequences for d1sg1x2:

Sequence; same for both SEQRES and ATOM records:

>d1sg1x2 g.24.1.1 (X:57-95) Low affinity neurotrophin receptor p75NTR {Rat (Rattus norvegicus)}
pcteclglqsmsapcveaddavcrcaygyyqdeetghce

Timeline for d1sg1x2:

• d1sg1x2 is new in SCOP 1.69
  
• d1sg1x2 appears in SCOP 1.71
  
• d1sg1x2 appears in the current release, SCOPe 2.08