![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.24: TNF receptor-like [57585] (1 superfamily) duplication: consists of three similar disulfide-rich domains |
![]() | Superfamily g.24.1: TNF receptor-like [57586] (3 families) ![]() |
![]() | Family g.24.1.1: TNF receptor-like [57587] (13 proteins) Pfam PF00020; TNFR/NGFR cysteine-rich region |
![]() | Domain d1sg1x2: 1sg1 X:57-95 [105516] Other proteins in same PDB: d1sg1a_, d1sg1b_, d1sg1x1, d1sg1x4 complexed with cl |
PDB Entry: 1sg1 (more details), 2.4 Å
SCOPe Domain Sequences for d1sg1x2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sg1x2 g.24.1.1 (X:57-95) Low affinity neurotrophin receptor p75NTR, domain 2 and domain 3 {Norway rat (Rattus norvegicus) [TaxId: 10116]} pcteclglqsmsapcveaddavcrcaygyyqdeetghce
Timeline for d1sg1x2: