Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.271: HSP90 C-terminal domain [110941] (1 superfamily) alpha-beta(3)-alpha(3); 2 layers, a/b; mixed beta-sheet, order:132; crossing loops |
Superfamily d.271.1: HSP90 C-terminal domain [110942] (1 family) automatically mapped to Pfam PF00183 |
Family d.271.1.1: HSP90 C-terminal domain [110943] (1 protein) C-terminal part of Pfam PF00183 |
Protein Chaperone protein HtpG [110944] (1 species) |
Species Escherichia coli [TaxId:562] [110945] (1 PDB entry) Uniprot P10413 511-624 |
Domain d1sf8h1: 1sf8 H:511-624 [105479] Other proteins in same PDB: d1sf8a2, d1sf8b2, d1sf8c2, d1sf8d2, d1sf8e2, d1sf8f2, d1sf8g2, d1sf8h2 complexed with cl, ni |
PDB Entry: 1sf8 (more details), 2.6 Å
SCOPe Domain Sequences for d1sf8h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sf8h1 d.271.1.1 (H:511-624) Chaperone protein HtpG {Escherichia coli [TaxId: 562]} fidrvkallgervkdvrlthrltdtpaivstdademstqmaklfaaagqkvpevkyifel npdhvlvkraadtedeakfsewvellldqallaergtledpnlfirrmnqllvs
Timeline for d1sf8h1: