SCOPe 2.07: Domain d1sf8e1: 1sf8 E:511-624

Lineage for d1sf8e1 (1sf8 E:511-624)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.271: HSP90 C-terminal domain [110941] (1 superfamily)
   alpha-beta(3)-alpha(3); 2 layers, a/b; mixed beta-sheet, order:132; crossing loops

4. Superfamily d.271.1: HSP90 C-terminal domain [110942] (1 family)
   automatically mapped to Pfam PF00183

5. Family d.271.1.1: HSP90 C-terminal domain [110943] (1 protein)
   C-terminal part of Pfam PF00183

6. Protein Chaperone protein HtpG [110944] (1 species)

7. Species Escherichia coli [TaxId:562] [110945] (1 PDB entry)
   Uniprot P10413 511-624

8. Domain d1sf8e1: 1sf8 E:511-624 [105476]
   Other proteins in same PDB: d1sf8a2, d1sf8b2, d1sf8c2, d1sf8d2, d1sf8e2, d1sf8f2, d1sf8g2, d1sf8h2
   complexed with cl, ni

Details for d1sf8e1

PDB Entry: 1sf8, 2.6 Å

PDB Description: Crystal structure of the carboxy-terminal domain of htpG, the E. coli Hsp90

PDB Compounds: (E:) Chaperone protein htpG

SCOPe Domain Sequences for d1sf8e1:

Sequence; same for both SEQRES and ATOM records:

>d1sf8e1 d.271.1.1 (E:511-624) Chaperone protein HtpG {Escherichia coli [TaxId: 562]}
fidrvkallgervkdvrlthrltdtpaivstdademstqmaklfaaagqkvpevkyifel
npdhvlvkraadtedeakfsewvellldqallaergtledpnlfirrmnqllvs

Timeline for d1sf8e1:

• d1sf8e1 first appeared in SCOP 1.69, called d1sf8e_
  
• d1sf8e1 appears in SCOPe 2.06
  
• d1sf8e1 appears in the current release, SCOPe 2.08