SCOPe 2.01: Domain d1seha_: 1seh A:

Lineage for d1seha_ (1seh A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)

7. Species Escherichia coli [TaxId:562] [51286] (10 PDB entries)
   Uniprot P06968

8. Domain d1seha_: 1seh A: [105454]
   complexed with trs, ump

Details for d1seha_

PDB Entry: 1seh, 1.47 Å

PDB Description: crystal structure of e. coli dutpase complexed with the product dump

PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d1seha_:

Sequence, based on SEQRES records:

>d1seha_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]}
mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
dpslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqm
ifvpvvqaefnlvedfdatdr

Sequence, based on observed residues (ATOM records):

>d1seha_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]}
mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
dpslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqm
ifvpvvqaefnlvedfdatr

Timeline for d1seha_:

• d1seha_ first appeared in SCOP 1.69
  
• d1seha_ appears in SCOP 1.75
  
• d1seha_ appears in SCOPe 2.02
  
• d1seha_ appears in the current release, SCOPe 2.08, called d1seha1