Lineage for d1seha1 (1seh A:2-141)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2072411Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2072562Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2072563Family b.85.4.1: dUTPase-like [51284] (5 protein domains)
  6. 2072633Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)
  7. 2072637Species Escherichia coli [TaxId:562] [51286] (10 PDB entries)
    Uniprot P06968
  8. 2072640Domain d1seha1: 1seh A:2-141 [105454]
    Other proteins in same PDB: d1seha2
    complexed with trs, ump

Details for d1seha1

PDB Entry: 1seh (more details), 1.47 Å

PDB Description: crystal structure of e. coli dutpase complexed with the product dump
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d1seha1:

Sequence, based on SEQRES records: (download)

>d1seha1 b.85.4.1 (A:2-141) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]}
mkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihiad
pslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqmi
fvpvvqaefnlvedfdatdr

Sequence, based on observed residues (ATOM records): (download)

>d1seha1 b.85.4.1 (A:2-141) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]}
mkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihiad
pslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqmi
fvpvvqaefnlvedfdatr

SCOPe Domain Coordinates for d1seha1:

Click to download the PDB-style file with coordinates for d1seha1.
(The format of our PDB-style files is described here.)

Timeline for d1seha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1seha2