![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.4: dUTPase-like [51283] (2 families) ![]() forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
![]() | Family b.85.4.1: dUTPase-like [51284] (5 proteins) |
![]() | Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species) |
![]() | Species Escherichia coli [TaxId:562] [51286] (10 PDB entries) Uniprot P06968 |
![]() | Domain d1seha1: 1seh A:2-141 [105454] Other proteins in same PDB: d1seha2 complexed with trs, ump |
PDB Entry: 1seh (more details), 1.47 Å
SCOPe Domain Sequences for d1seha1:
Sequence, based on SEQRES records: (download)
>d1seha1 b.85.4.1 (A:2-141) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]} mkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihiad pslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqmi fvpvvqaefnlvedfdatdr
>d1seha1 b.85.4.1 (A:2-141) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]} mkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihiad pslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqmi fvpvvqaefnlvedfdatr
Timeline for d1seha1: