Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
Protein UDP-N-acetylglucosamine 4-epimerase WbpP [110407] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [110408] (2 PDB entries) Uniprot Q8KN66 # list: Q8GGB8 Q9RHD6 99% identity |
Domain d1sb9a_: 1sb9 A: [105411] complexed with nad, upg has additional subdomain(s) that are not in the common domain |
PDB Entry: 1sb9 (more details), 2.5 Å
SCOPe Domain Sequences for d1sb9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sb9a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} msryeelrkelpaqpkvwlitgvagfigsnlletllkldqkvvgldnfatghqrnldevr slvsekqwsnfkfiqgdirnlddcnnacagvdyvlhqaalgsvprsindpitsnatnidg flnmliaardakvqsftyaassstygdhpglpkvedtigkplspyavtkyvnelyadvfs rcygfstiglryfnvfgrrqdpngayaavipkwtssmiqgddvyingdgetsrdfcyien tvqanllaatagldarnqvyniavggrtslnqlffalrdglaengvsyhrepvyrdfreg dvrhsladiskaakllgyapkydvsagvalampwyimflk
Timeline for d1sb9a_: