SCOPe 2.06: Domain d1s80f1: 1s80 F:2-240

Lineage for d1s80f1 (1s80 F:2-240)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.6: Serine acetyltransferase [110309] (2 proteins)
   this is a repeat family; one repeat unit is 1t3d A:205-223 found in domain

6. Protein Serine acetyltransferase [110310] (2 species)
   extra N-terminal all-alpha subdomain belongs to Pfam PF06426

7. Species Haemophilus influenzae [TaxId:727] [110311] (4 PDB entries)
   Uniprot P43886 1-241

8. Domain d1s80f1: 1s80 F:2-240 [105363]
   Other proteins in same PDB: d1s80a2, d1s80b2, d1s80c2, d1s80d2, d1s80e2, d1s80f2
   Structural genomics target

Details for d1s80f1

PDB Entry: 1s80, 2.7 Å

PDB Description: structure of serine acetyltransferase from haemophilis influenzae rd

PDB Compounds: (F:) Serine acetyltransferase

SCOPe Domain Sequences for d1s80f1:

Sequence; same for both SEQRES and ATOM records:

>d1s80f1 b.81.1.6 (F:2-240) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]}
tldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislre
iieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqnr
kslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlggt
gkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv

Timeline for d1s80f1:

• d1s80f1 first appeared in SCOP 1.69, called d1s80f_
  
• d1s80f1 was called d1s80f_ in SCOPe 2.05
  
• d1s80f1 appears in SCOPe 2.07
  
• d1s80f1 appears in the current release, SCOPe 2.08