Lineage for d1s80f1 (1s80 F:2-240)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403213Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2403214Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2403440Family b.81.1.6: Serine acetyltransferase [110309] (2 protein domains)
  6. 2403441Protein Serine acetyltransferase [110310] (2 species)
    extra N-terminal all-alpha subdomain belongs to Pfam PF06426
  7. 2403446Species Haemophilus influenzae [TaxId:727] [110311] (4 PDB entries)
    Uniprot P43886 1-241
  8. 2403463Domain d1s80f1: 1s80 F:2-240 [105363]
    Other proteins in same PDB: d1s80a2, d1s80b2, d1s80c2, d1s80d2, d1s80e2, d1s80f2
    Structural genomics target

Details for d1s80f1

PDB Entry: 1s80 (more details), 2.7 Å

PDB Description: Structure of Serine Acetyltransferase from Haemophilis influenzae Rd
PDB Compounds: (F:) Serine acetyltransferase

SCOPe Domain Sequences for d1s80f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s80f1 b.81.1.6 (F:2-240) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]}
tldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislre
iieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqnr
kslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlggt
gkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv

SCOPe Domain Coordinates for d1s80f1:

Click to download the PDB-style file with coordinates for d1s80f1.
(The format of our PDB-style files is described here.)

Timeline for d1s80f1: