![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.48: MTH1187/YkoF-like [89957] (3 families) ![]() |
![]() | Family d.58.48.2: Putative thiamin/HMP-binding protein YkoF [110987] (1 protein) duplication: one subunit consists of two domains assembled as in the MHT1178-like dimer |
![]() | Protein Putative thiamin/HMP-binding protein YkoF [110988] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [110989] (3 PDB entries) Uniprot O34911 |
![]() | Domain d1s7hd_: 1s7h D: [105352] Structural genomics target |
PDB Entry: 1s7h (more details), 2.2 Å
SCOPe Domain Sequences for d1s7hd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s7hd_ d.58.48.2 (D:) Putative thiamin/HMP-binding protein YkoF {Bacillus subtilis [TaxId: 1423]} riagfrfslypmtddfisviksalkktdtskvwtktdhistvlrgsidhvfdaakaiylh aanseqhivmngtfsigcpgdtqgdtylskgdkrvnedavrglkaeapcqfalypmnepd ymglimeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnhitmtvnls ansp
Timeline for d1s7hd_: