Lineage for d1s7hc_ (1s7h C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955711Superfamily d.58.48: MTH1187/YkoF-like [89957] (3 families) (S)
  5. 2955737Family d.58.48.2: Putative thiamin/HMP-binding protein YkoF [110987] (1 protein)
    duplication: one subunit consists of two domains assembled as in the MHT1178-like dimer
  6. 2955738Protein Putative thiamin/HMP-binding protein YkoF [110988] (1 species)
  7. 2955739Species Bacillus subtilis [TaxId:1423] [110989] (3 PDB entries)
    Uniprot O34911
  8. 2955744Domain d1s7hc_: 1s7h C: [105351]
    Structural genomics target

Details for d1s7hc_

PDB Entry: 1s7h (more details), 2.2 Å

PDB Description: Structural Genomics, 2.2A crystal structure of protein YKOF from Bacillus subtilis
PDB Compounds: (C:) ykoF

SCOPe Domain Sequences for d1s7hc_:

Sequence, based on SEQRES records: (download)

>d1s7hc_ d.58.48.2 (C:) Putative thiamin/HMP-binding protein YkoF {Bacillus subtilis [TaxId: 1423]}
riagfrfslypmtddfisviksalkktdtskvwtktdhistvlrgsidhvfdaakaiylh
aanseqhivmngtfsigcpgdtqgdtylskgdkrvnedavrglkaeapcqfalypmnepd
ymglimeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnhitmtvnls
ansp

Sequence, based on observed residues (ATOM records): (download)

>d1s7hc_ d.58.48.2 (C:) Putative thiamin/HMP-binding protein YkoF {Bacillus subtilis [TaxId: 1423]}
riagfrfslypmtddfisviksalkktdtskvwtktdhistvlrgsidhvfdaakaiylh
aanseqhivmngtfsigcpgdtqgdtylskkrvnedavrglkaeapcqfalypmnepdym
glimeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnhitmtvnlsan
sp

SCOPe Domain Coordinates for d1s7hc_:

Click to download the PDB-style file with coordinates for d1s7hc_.
(The format of our PDB-style files is described here.)

Timeline for d1s7hc_: