Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.48: MTH1187/YkoF-like [89957] (3 families) |
Family d.58.48.2: Putative thiamin/HMP-binding protein YkoF [110987] (1 protein) duplication: one subunit consists of two domains assembled as in the MHT1178-like dimer |
Protein Putative thiamin/HMP-binding protein YkoF [110988] (1 species) |
Species Bacillus subtilis [TaxId:1423] [110989] (3 PDB entries) Uniprot O34911 |
Domain d1s7hc_: 1s7h C: [105351] Structural genomics target |
PDB Entry: 1s7h (more details), 2.2 Å
SCOPe Domain Sequences for d1s7hc_:
Sequence, based on SEQRES records: (download)
>d1s7hc_ d.58.48.2 (C:) Putative thiamin/HMP-binding protein YkoF {Bacillus subtilis [TaxId: 1423]} riagfrfslypmtddfisviksalkktdtskvwtktdhistvlrgsidhvfdaakaiylh aanseqhivmngtfsigcpgdtqgdtylskgdkrvnedavrglkaeapcqfalypmnepd ymglimeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnhitmtvnls ansp
>d1s7hc_ d.58.48.2 (C:) Putative thiamin/HMP-binding protein YkoF {Bacillus subtilis [TaxId: 1423]} riagfrfslypmtddfisviksalkktdtskvwtktdhistvlrgsidhvfdaakaiylh aanseqhivmngtfsigcpgdtqgdtylskkrvnedavrglkaeapcqfalypmnepdym glimeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnhitmtvnlsan sp
Timeline for d1s7hc_: