PDB entry 1s7h

View 1s7h on RCSB PDB site
Description: Structural Genomics, 2.2A crystal structure of protein YKOF from Bacillus subtilis
Class: structural genomics, unknown function
Keywords: Structural genomics, Protein YKOF, alpha-beta-beta-alpha sandwich, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2004-01-29, released 2004-07-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.221
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ykoF
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YKOF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s7ha_
  • Chain 'B':
    Compound: ykoF
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YKOF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s7hb_
  • Chain 'C':
    Compound: ykoF
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YKOF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s7hc_
  • Chain 'D':
    Compound: ykoF
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YKOF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s7hd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s7hA (A:)
    mehicgtsriagfrfslypmtddfisviksalkktdtskvwtktdhistvlrgsidhvfd
    aakaiylhaanseqhivmngtfsigcpgdtqgdtylskgdkrvnedavrglkaeapcqfa
    lypmnepdymglimeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnh
    itmtvnlsanspsrknrkqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7hA (A:)
    sriagfrfslypmtddfisviksalkktdtskvwtktdhistvlrgsidhvfdaakaiyl
    haanseqhivmngtfsigcpgdtqgdtylskgdkrvnedavrglkaeapcqfalypmnep
    dymglimeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnhitmtvnl
    sansps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s7hB (B:)
    mehicgtsriagfrfslypmtddfisviksalkktdtskvwtktdhistvlrgsidhvfd
    aakaiylhaanseqhivmngtfsigcpgdtqgdtylskgdkrvnedavrglkaeapcqfa
    lypmnepdymglimeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnh
    itmtvnlsanspsrknrkqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7hB (B:)
    riagfrfslypmtddfisviksalkktdtskvwtktdhistvlrgsidhvfdaakaiylh
    aanseqhivmngtfsigcpgdtqgdtykrvnedavrglkaeapcqfalypmnepdymgli
    meavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnhitmtvnlsansps
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1s7hC (C:)
    mehicgtsriagfrfslypmtddfisviksalkktdtskvwtktdhistvlrgsidhvfd
    aakaiylhaanseqhivmngtfsigcpgdtqgdtylskgdkrvnedavrglkaeapcqfa
    lypmnepdymglimeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnh
    itmtvnlsanspsrknrkqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7hC (C:)
    riagfrfslypmtddfisviksalkktdtskvwtktdhistvlrgsidhvfdaakaiylh
    aanseqhivmngtfsigcpgdtqgdtylskkrvnedavrglkaeapcqfalypmnepdym
    glimeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnhitmtvnlsan
    sp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1s7hD (D:)
    mehicgtsriagfrfslypmtddfisviksalkktdtskvwtktdhistvlrgsidhvfd
    aakaiylhaanseqhivmngtfsigcpgdtqgdtylskgdkrvnedavrglkaeapcqfa
    lypmnepdymglimeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnh
    itmtvnlsanspsrknrkqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s7hD (D:)
    riagfrfslypmtddfisviksalkktdtskvwtktdhistvlrgsidhvfdaakaiylh
    aanseqhivmngtfsigcpgdtqgdtylskgdkrvnedavrglkaeapcqfalypmnepd
    ymglimeavdiakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnhitmtvnls
    ansp