Lineage for d1s6na_ (1s6n A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1111574Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1111941Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 1111942Protein Envelope glycoprotein [49213] (5 species)
  7. 1111975Species West Nile virus [TaxId:11082] [110056] (1 PDB entry)
    Uniprot Q8JU42 586-696
  8. 1111976Domain d1s6na_: 1s6n A: [105311]

Details for d1s6na_

PDB Entry: 1s6n (more details)

PDB Description: NMR Structure of Domain III of the West Nile Virus Envelope Protein, Strain 385-99
PDB Compounds: (A:) Envelope glycoprotein

SCOPe Domain Sequences for d1s6na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s6na_ b.1.18.4 (A:) Envelope glycoprotein {West Nile virus [TaxId: 11082]}
isefqlkgttygvcskafkflgtpadtghgtvvlelqytgtdgpckvpissvaslndltp
vgrlvtvnpfvsvatanakvlieleppfgdsyivvgrgeqqinhhwhksgssigk

SCOPe Domain Coordinates for d1s6na_:

Click to download the PDB-style file with coordinates for d1s6na_.
(The format of our PDB-style files is described here.)

Timeline for d1s6na_: