Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (18 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (2 proteins) |
Protein Envelope glycoprotein [49213] (4 species) |
Species West Nile virus [TaxId:11082] [110056] (1 PDB entry) |
Domain d1s6na_: 1s6n A: [105311] |
PDB Entry: 1s6n (more details)
SCOP Domain Sequences for d1s6na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s6na_ b.1.18.4 (A:) Envelope glycoprotein {West Nile virus} isefqlkgttygvcskafkflgtpadtghgtvvlelqytgtdgpckvpissvaslndltp vgrlvtvnpfvsvatanakvlieleppfgdsyivvgrgeqqinhhwhksgssigk
Timeline for d1s6na_: