Lineage for d1s6na_ (1s6n A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 456110Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 456387Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (2 proteins)
  6. 456388Protein Envelope glycoprotein [49213] (4 species)
  7. 456412Species West Nile virus [TaxId:11082] [110056] (1 PDB entry)
  8. 456413Domain d1s6na_: 1s6n A: [105311]

Details for d1s6na_

PDB Entry: 1s6n (more details)

PDB Description: NMR Structure of Domain III of the West Nile Virus Envelope Protein, Strain 385-99

SCOP Domain Sequences for d1s6na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s6na_ b.1.18.4 (A:) Envelope glycoprotein {West Nile virus}
isefqlkgttygvcskafkflgtpadtghgtvvlelqytgtdgpckvpissvaslndltp
vgrlvtvnpfvsvatanakvlieleppfgdsyivvgrgeqqinhhwhksgssigk

SCOP Domain Coordinates for d1s6na_:

Click to download the PDB-style file with coordinates for d1s6na_.
(The format of our PDB-style files is described here.)

Timeline for d1s6na_: