Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1s30a2 (1s30 A:148-191)

  1. Root: SCOP 1.75B
  2. Class g: Small proteins [56992] (90 folds)
  3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. Family g.41.5.1: Rubredoxin [57803] (5 protein domains)
  6. Protein Rubrerythrin, C-terminal domain [57811] (2 species)
  7. Species Desulfovibrio vulgaris [TaxId:881] [57812] (10 PDB entries)
    Uniprot P24931
  8. Domain d1s30a2: 1s30 A:148-191 [105233]
    Other proteins in same PDB: d1s30a1
    complexed with fe, zn

Details for d1s30a2

PDB Entry: 1s30 (more details)
PDB Description: x-ray crystal structure of desulfovibrio vulgaris rubrerythr displacement of iron by zinc at the diiron site
PDB Compounds: (A:) rubrerythrin

SCOP Domain Sequences for d1s30a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s30a2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}
flreqatkwrcrncgyvhegtgapelcpacahpkahfellginw

SCOP Domain Coordinates for d1s30a2:

Click to download the PDB-style file with coordinates for d1s30a2.
(The format of our PDB-style files is described here.)

Timeline for d1s30a2:

d1s30a2 appears in SCOP 1.75A


d1s30a2
(click for larger image)


d1s30a2 in context of chain
Domains from same chain:
d1s30a1

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu