Lineage for d1rzma_ (1rzm A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683918Superfamily c.1.10: Aldolase [51569] (8 families) (S)
    Common fold covers whole protein structure
  5. 684412Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins)
  6. 684413Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (3 species)
  7. 684486Species Thermotoga maritima [TaxId:2336] [110363] (2 PDB entries)
  8. 684491Domain d1rzma_: 1rzm A: [105137]

Details for d1rzma_

PDB Entry: 1rzm (more details), 2.2 Å

PDB Description: Crystal structure of 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHPS) from Thermotoga maritima complexed with Cd2+, PEP and E4P
PDB Compounds: (A:) phospho-2-dehydro-3-deoxyheptonate aldolase

SCOP Domain Sequences for d1rzma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzma_ c.1.10.4 (A:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Thermotoga maritima [TaxId: 2336]}
mivvlkpgsteedirkvvklaesynlkchiskgqertvigiigddryvvadkfesldcve
svvrvlkpyklvsrefhpedtvidlgdvkigngyftiiagpcsvegremlmetahflsel
gvkvlrggaykprtspysfqglgekgleylreaadkygmyvvtealgeddlpkvaeyadi
iqigarnaqnfrllskagsynkpvllkrgfmntieefllsaeyiansgntkiilcergir
tfekatrntldisavpiirkeshlpilvdpshsggrrdlviplsraaiavgahgiivevh
pepekalsdgkqsldfelfkelvqemkkladalgvkvn

SCOP Domain Coordinates for d1rzma_:

Click to download the PDB-style file with coordinates for d1rzma_.
(The format of our PDB-style files is described here.)

Timeline for d1rzma_: