SCOP 1.69: Domain d1rzma_: 1rzm A:

Lineage for d1rzma_ (1rzm A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (6 families)
   Common fold covers whole protein structure

5. Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins)

6. Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (3 species)

7. Species Thermotoga maritima [TaxId:243274] [110363] (1 PDB entry)

8. Domain d1rzma_: 1rzm A: [105137]

Details for d1rzma_

PDB Entry: 1rzm, 2.2 Å

PDB Description: Crystal structure of 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHPS) from Thermotoga maritima complexed with Cd2+, PEP and E4P

SCOP Domain Sequences for d1rzma_:

Sequence; same for both SEQRES and ATOM records:

>d1rzma_ c.1.10.4 (A:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Thermotoga maritima}
mivvlkpgsteedirkvvklaesynlkchiskgqertvigiigddryvvadkfesldcve
svvrvlkpyklvsrefhpedtvidlgdvkigngyftiiagpcsvegremlmetahflsel
gvkvlrggaykprtspysfqglgekgleylreaadkygmyvvtealgeddlpkvaeyadi
iqigarnaqnfrllskagsynkpvllkrgfmntieefllsaeyiansgntkiilcergir
tfekatrntldisavpiirkeshlpilvdpshsggrrdlviplsraaiavgahgiivevh
pepekalsdgkqsldfelfkelvqemkkladalgvkvn

Timeline for d1rzma_:

• d1rzma_ is new in SCOP 1.69
  
• d1rzma_ appears in SCOP 1.71
  
• d1rzma_ appears in the current release, SCOPe 2.08