Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (8 families) Common fold covers whole protein structure |
Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins) |
Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (3 species) |
Species Thermotoga maritima [TaxId:2336] [110363] (2 PDB entries) |
Domain d1rzmb_: 1rzm B: [105138] complexed with cd, e4p, pep |
PDB Entry: 1rzm (more details), 2.2 Å
SCOP Domain Sequences for d1rzmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rzmb_ c.1.10.4 (B:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Thermotoga maritima [TaxId: 2336]} mivvlkpgsteedirkvvklaesynlkchiskgqertvigiigddryvvadkfesldcve svvrvlkpyklvsrefhpedtvidlgdvkigngyftiiagpcsvegremlmetahflsel gvkvlrggaykprtspysfqglgekgleylreaadkygmyvvtealgeddlpkvaeyadi iqigarnaqnfrllskagsynkpvllkrgfmntieefllsaeyiansgntkiilcergir tfekatrntldisavpiirkeshlpilvdpshsggrrdlviplsraaiavgahgiivevh pepekalsdgkqsldfelfkelvqemkkladalgvkvn
Timeline for d1rzmb_: