SCOP 1.73: Domain d1rzmb_: 1rzm B:

Lineage for d1rzmb_ (1rzm B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (8 families)
   Common fold covers whole protein structure

5. Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins)

6. Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (3 species)

7. Species Thermotoga maritima [TaxId:2336] [110363] (2 PDB entries)

8. Domain d1rzmb_: 1rzm B: [105138]
   complexed with cd, e4p, pep

Details for d1rzmb_

PDB Entry: 1rzm, 2.2 Å

PDB Description: Crystal structure of 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHPS) from Thermotoga maritima complexed with Cd2+, PEP and E4P

PDB Compounds: (B:) phospho-2-dehydro-3-deoxyheptonate aldolase

SCOP Domain Sequences for d1rzmb_:

Sequence; same for both SEQRES and ATOM records:

>d1rzmb_ c.1.10.4 (B:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Thermotoga maritima [TaxId: 2336]}
mivvlkpgsteedirkvvklaesynlkchiskgqertvigiigddryvvadkfesldcve
svvrvlkpyklvsrefhpedtvidlgdvkigngyftiiagpcsvegremlmetahflsel
gvkvlrggaykprtspysfqglgekgleylreaadkygmyvvtealgeddlpkvaeyadi
iqigarnaqnfrllskagsynkpvllkrgfmntieefllsaeyiansgntkiilcergir
tfekatrntldisavpiirkeshlpilvdpshsggrrdlviplsraaiavgahgiivevh
pepekalsdgkqsldfelfkelvqemkkladalgvkvn

Timeline for d1rzmb_:

• d1rzmb_ first appeared in SCOP 1.69
  
• d1rzmb_ appears in SCOP 1.71
  
• d1rzmb_ appears in SCOP 1.75
  
• d1rzmb_ appears in the current release, SCOPe 2.08