Lineage for d1ru5a_ (1ru5 A:)

  1. Root: SCOP 1.69
  2. 528313Class j: Peptides [58231] (116 folds)
  3. 528507Fold j.6: Peptide hormones [58283] (1 superfamily)
    contains one alpha-helix
  4. 528508Superfamily j.6.1: Peptide hormones [58284] (1 family) (S)
    this is not a true superfamily
  5. 528509Family j.6.1.1: Peptide hormones [58285] (17 proteins)
  6. 528576Protein Porcine peptide YY [58292] (1 species)
  7. 528577Species Pig (Sus scrofa) [TaxId:9823] [58293] (3 PDB entries)
  8. 528578Domain d1ru5a_: 1ru5 A: [105099]

Details for d1ru5a_

PDB Entry: 1ru5 (more details)

PDB Description: solution structure of porcine peptide yy (ppyy)

SCOP Domain Sequences for d1ru5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ru5a_ j.6.1.1 (A:) Porcine peptide YY {Pig (Sus scrofa)}
ypakpeapgedaspeelsryyaslrhylnlvtrqry

SCOP Domain Coordinates for d1ru5a_:

Click to download the PDB-style file with coordinates for d1ru5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ru5a_: