PDB entry 1ru5

View 1ru5 on RCSB PDB site
Description: solution structure of porcine peptide yy (ppyy)
Deposited on 2003-12-11, released 2004-06-08
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-08, with a file datestamp of 2004-06-08.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ru5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ru5A (A:)
    ypakpeapgedaspeelsryyaslrhylnlvtrqry