![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families) ![]() |
![]() | Family g.41.3.1: Transcriptional factor domain [57784] (6 proteins) |
![]() | Protein Transcription initiation factor TFIIB, N-terminal domain [57789] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57791] (3 PDB entries) Uniprot Q00403 2-59 |
![]() | Domain d1rlya_: 1rly A: [104988] complexed with zn |
PDB Entry: 1rly (more details)
SCOPe Domain Sequences for d1rlya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rlya_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} astsrldalprvtcpnhpdailvedyragdmicpecglvvgdrvidvgsewrtfsndk
Timeline for d1rlya_: