SCOPe 2.07: Domain d1rlub2: 1rlu B:206-312

Lineage for d1rlub2 (1rlu B:206-312)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein Cell-division protein FtsZ [55309] (9 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [111032] (6 PDB entries)
   Uniprot O08378

8. Domain d1rlub2: 1rlu B:206-312 [104987]
   Other proteins in same PDB: d1rlua1, d1rlub1
   complexed with gol, gsp

Details for d1rlub2

PDB Entry: 1rlu, 2.08 Å

PDB Description: mycobacterium tuberculosis ftsz in complex with gtp-gamma-s

PDB Compounds: (B:) cell division protein ftsz

SCOPe Domain Sequences for d1rlub2:

Sequence; same for both SEQRES and ATOM records:

>d1rlub2 d.79.2.1 (B:206-312) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
vdfadvkgimsgagtalmgigsargegrslkaaeiainsplleasmegaqgvlmsiaggs
dlglfeineaaslvqdaahpdaniifgtviddslgdevrvtviaagf

Timeline for d1rlub2:

• d1rlub2 first appeared in SCOP 1.69
  
• d1rlub2 appears in SCOPe 2.06
  
• d1rlub2 appears in the current release, SCOPe 2.08