Lineage for d1rlub2 (1rlu B:206-312)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959093Protein Cell-division protein FtsZ [55309] (9 species)
  7. 2959124Species Mycobacterium tuberculosis [TaxId:1773] [111032] (6 PDB entries)
    Uniprot O08378
  8. 2959128Domain d1rlub2: 1rlu B:206-312 [104987]
    Other proteins in same PDB: d1rlua1, d1rlub1
    complexed with gol, gsp
    missing some secondary structures that made up less than one-third of the common domain

Details for d1rlub2

PDB Entry: 1rlu (more details), 2.08 Å

PDB Description: mycobacterium tuberculosis ftsz in complex with gtp-gamma-s
PDB Compounds: (B:) cell division protein ftsz

SCOPe Domain Sequences for d1rlub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlub2 d.79.2.1 (B:206-312) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
vdfadvkgimsgagtalmgigsargegrslkaaeiainsplleasmegaqgvlmsiaggs
dlglfeineaaslvqdaahpdaniifgtviddslgdevrvtviaagf

SCOPe Domain Coordinates for d1rlub2:

Click to download the PDB-style file with coordinates for d1rlub2.
(The format of our PDB-style files is described here.)

Timeline for d1rlub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rlub1