![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
![]() | Protein Cell-division protein FtsZ [55309] (9 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [111032] (6 PDB entries) Uniprot O08378 |
![]() | Domain d1rlub2: 1rlu B:206-312 [104987] Other proteins in same PDB: d1rlua1, d1rlub1 complexed with gol, gsp missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1rlu (more details), 2.08 Å
SCOPe Domain Sequences for d1rlub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rlub2 d.79.2.1 (B:206-312) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} vdfadvkgimsgagtalmgigsargegrslkaaeiainsplleasmegaqgvlmsiaggs dlglfeineaaslvqdaahpdaniifgtviddslgdevrvtviaagf
Timeline for d1rlub2: