SCOPe 2.02: Domain d1rgia1: 1rgi A:5-146

Lineage for d1rgia1 (1rgi A:5-146)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin [53073] (6 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (41 PDB entries)
   Uniprot P02568 ! SQ 02568

8. Domain d1rgia1: 1rgi A:5-146 [104926]
   Other proteins in same PDB: d1rgig1, d1rgig2, d1rgig3
   complexed with atp, ca

Details for d1rgia1

PDB Entry: 1rgi, 3 Å

PDB Description: crystal structure of gelsolin domains g1-g3 bound to actin

PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d1rgia1:

Sequence, based on SEQRES records:

>d1rgia1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d1rgia1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprkdsyvgdeaqskrgiltlkypiehg
iitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyv
aiqavlslyasg

Timeline for d1rgia1:

• d1rgia1 first appeared in SCOP 1.69
  
• d1rgia1 appears in SCOPe 2.01
  
• d1rgia1 appears in SCOPe 2.03
  
• d1rgia1 appears in the current release, SCOPe 2.08