Lineage for d1rgia1 (1rgi A:5-146)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 488062Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 488063Superfamily c.55.1: Actin-like ATPase domain [53067] (10 families) (S)
    duplication contains two domains of this fold
  5. 488064Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 488065Protein Actin [53073] (6 species)
  7. 488084Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (20 PDB entries)
  8. 488117Domain d1rgia1: 1rgi A:5-146 [104926]
    Other proteins in same PDB: d1rgig1, d1rgig2, d1rgig3

Details for d1rgia1

PDB Entry: 1rgi (more details), 3 Å

PDB Description: crystal structure of gelsolin domains g1-g3 bound to actin

SCOP Domain Sequences for d1rgia1:

Sequence, based on SEQRES records: (download)

>d1rgia1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus)}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d1rgia1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus)}
ttalvcdngsglvkagfagddapravfpsivgrprkdsyvgdeaqskrgiltlkypiehg
iitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyv
aiqavlslyasg

SCOP Domain Coordinates for d1rgia1:

Click to download the PDB-style file with coordinates for d1rgia1.
(The format of our PDB-style files is described here.)

Timeline for d1rgia1: