Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (10 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) |
Protein Actin [53073] (6 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (20 PDB entries) |
Domain d1rgia1: 1rgi A:5-146 [104926] Other proteins in same PDB: d1rgig1, d1rgig2, d1rgig3 |
PDB Entry: 1rgi (more details), 3 Å
SCOP Domain Sequences for d1rgia1:
Sequence, based on SEQRES records: (download)
>d1rgia1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus)} ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf etfnvpamyvaiqavlslyasg
>d1rgia1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus)} ttalvcdngsglvkagfagddapravfpsivgrprkdsyvgdeaqskrgiltlkypiehg iitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyv aiqavlslyasg
Timeline for d1rgia1: