Lineage for d1r9da_ (1r9d A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097778Fold c.7: PFL-like glycyl radical enzymes [51997] (1 superfamily)
    contains: barrel, closed; n=10, S=10; accommodates a hairpin loop inside the barrel
  4. 2097779Superfamily c.7.1: PFL-like glycyl radical enzymes [51998] (6 families) (S)
    duplication: the N- and C-terminal halves have similar topologies
  5. 2097780Family c.7.1.1: PFL-like [51999] (2 protein domains)
    Pfam PF02901; except the C-terminal ~100 residues covered by Pfam PF01228
  6. 2097781Protein Glycerol dehydratase DhaB1 [110445] (1 species)
  7. 2097782Species Clostridium butyricum [TaxId:1492] [110446] (4 PDB entries)
    Uniprot Q8GEZ8
  8. 2097783Domain d1r9da_: 1r9d A: [104865]
    complexed with gol

Details for d1r9da_

PDB Entry: 1r9d (more details), 1.8 Å

PDB Description: Glycerol bound form of the B12-independent glycerol dehydratase from Clostridium butyricum
PDB Compounds: (A:) glycerol dehydratase

SCOPe Domain Sequences for d1r9da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r9da_ c.7.1.1 (A:) Glycerol dehydratase DhaB1 {Clostridium butyricum [TaxId: 1492]}
iskgfstqterinilkaqilnakpcveserailitesfkqtegqpailrralalkhilen
ipitirdqelivgsltkeprssqvfpefsnkwlqdeldrlnkrtgdafqiseeskeklkd
vfeywngkttselatsymteetreavncdvftvgnyyyngvghvsvdygkvlrvgfngii
neakeqleknrsidpdfikkekflnsviisceaaityvnryakkakeiadntsdakrkae
lneiakicskvsgegaksfyeacqlfwfihaiiniesnghsisparfdqymypyyendkn
itdkfaqelidciwiklndinkvrdeistkhfggypmyqnlivggqnsegkdatnkvsym
aleaavhvklpqpslsvriwnktpdefllraaeltreglglpayyndeviipalvsrglt
ledardygiigcvepqkpgktegwhdsaffnlariveltinsgfdknkqigpktqnfeem
ksfdefmkaykaqmeyfvkhmccadncidiahaeraplpflssmvdncigkgkslqdgga
eynfsgpqgvgvanigdslvavkkivfdenkitpselkktlnndfknseeiqallknapk
fgndidevdnlaregalvycrevnkytnprggnfqpglypssinvyfgsltgatpdgrks
gqpladgvspsrgcdvsgptaacnsvskldhfiasngtlfnqkfhpsalkgdnglmnlss
lirsyfdqkgfhvqfnvidkkillaaqknpekyqdlivrvagysaqfisldksiqndiia
rtehvm

SCOPe Domain Coordinates for d1r9da_:

Click to download the PDB-style file with coordinates for d1r9da_.
(The format of our PDB-style files is described here.)

Timeline for d1r9da_: