PDB entry 1r9d

View 1r9d on RCSB PDB site
Description: Glycerol bound form of the B12-independent glycerol dehydratase from Clostridium butyricum
Class: lyase
Keywords: glycerol dehydratase, radical SAM, LYASE
Deposited on 2003-10-28, released 2004-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.217
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycerol dehydratase
    Species: Clostridium butyricum [TaxId:1492]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r9da_
  • Chain 'B':
    Compound: glycerol dehydratase
    Species: Clostridium butyricum [TaxId:1492]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r9db_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r9dA (A:)
    miskgfstqterinilkaqilnakpcveserailitesfkqtegqpailrralalkhile
    nipitirdqelivgsltkeprssqvfpefsnkwlqdeldrlnkrtgdafqiseeskeklk
    dvfeywngkttselatsymteetreavncdvftvgnyyyngvghvsvdygkvlrvgfngi
    ineakeqleknrsidpdfikkekflnsviisceaaityvnryakkakeiadntsdakrka
    elneiakicskvsgegaksfyeacqlfwfihaiiniesnghsisparfdqymypyyendk
    nitdkfaqelidciwiklndinkvrdeistkhfggypmyqnlivggqnsegkdatnkvsy
    maleaavhvklpqpslsvriwnktpdefllraaeltreglglpayyndeviipalvsrgl
    tledardygiigcvepqkpgktegwhdsaffnlariveltinsgfdknkqigpktqnfee
    mksfdefmkaykaqmeyfvkhmccadncidiahaeraplpflssmvdncigkgkslqdgg
    aeynfsgpqgvgvanigdslvavkkivfdenkitpselkktlnndfknseeiqallknap
    kfgndidevdnlaregalvycrevnkytnprggnfqpglypssinvyfgsltgatpdgrk
    sgqpladgvspsrgcdvsgptaacnsvskldhfiasngtlfnqkfhpsalkgdnglmnls
    slirsyfdqkgfhvqfnvidkkillaaqknpekyqdlivrvagysaqfisldksiqndii
    artehvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r9dA (A:)
    iskgfstqterinilkaqilnakpcveserailitesfkqtegqpailrralalkhilen
    ipitirdqelivgsltkeprssqvfpefsnkwlqdeldrlnkrtgdafqiseeskeklkd
    vfeywngkttselatsymteetreavncdvftvgnyyyngvghvsvdygkvlrvgfngii
    neakeqleknrsidpdfikkekflnsviisceaaityvnryakkakeiadntsdakrkae
    lneiakicskvsgegaksfyeacqlfwfihaiiniesnghsisparfdqymypyyendkn
    itdkfaqelidciwiklndinkvrdeistkhfggypmyqnlivggqnsegkdatnkvsym
    aleaavhvklpqpslsvriwnktpdefllraaeltreglglpayyndeviipalvsrglt
    ledardygiigcvepqkpgktegwhdsaffnlariveltinsgfdknkqigpktqnfeem
    ksfdefmkaykaqmeyfvkhmccadncidiahaeraplpflssmvdncigkgkslqdgga
    eynfsgpqgvgvanigdslvavkkivfdenkitpselkktlnndfknseeiqallknapk
    fgndidevdnlaregalvycrevnkytnprggnfqpglypssinvyfgsltgatpdgrks
    gqpladgvspsrgcdvsgptaacnsvskldhfiasngtlfnqkfhpsalkgdnglmnlss
    lirsyfdqkgfhvqfnvidkkillaaqknpekyqdlivrvagysaqfisldksiqndiia
    rtehvm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r9dB (B:)
    miskgfstqterinilkaqilnakpcveserailitesfkqtegqpailrralalkhile
    nipitirdqelivgsltkeprssqvfpefsnkwlqdeldrlnkrtgdafqiseeskeklk
    dvfeywngkttselatsymteetreavncdvftvgnyyyngvghvsvdygkvlrvgfngi
    ineakeqleknrsidpdfikkekflnsviisceaaityvnryakkakeiadntsdakrka
    elneiakicskvsgegaksfyeacqlfwfihaiiniesnghsisparfdqymypyyendk
    nitdkfaqelidciwiklndinkvrdeistkhfggypmyqnlivggqnsegkdatnkvsy
    maleaavhvklpqpslsvriwnktpdefllraaeltreglglpayyndeviipalvsrgl
    tledardygiigcvepqkpgktegwhdsaffnlariveltinsgfdknkqigpktqnfee
    mksfdefmkaykaqmeyfvkhmccadncidiahaeraplpflssmvdncigkgkslqdgg
    aeynfsgpqgvgvanigdslvavkkivfdenkitpselkktlnndfknseeiqallknap
    kfgndidevdnlaregalvycrevnkytnprggnfqpglypssinvyfgsltgatpdgrk
    sgqpladgvspsrgcdvsgptaacnsvskldhfiasngtlfnqkfhpsalkgdnglmnls
    slirsyfdqkgfhvqfnvidkkillaaqknpekyqdlivrvagysaqfisldksiqndii
    artehvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r9dB (B:)
    iskgfstqterinilkaqilnakpcveserailitesfkqtegqpailrralalkhilen
    ipitirdqelivgsltkeprssqvfpefsnkwlqdeldrlnkrtgdafqiseeskeklkd
    vfeywngkttselatsymteetreavncdvftvgnyyyngvghvsvdygkvlrvgfngii
    neakeqleknrsidpdfikkekflnsviisceaaityvnryakkakeiadntsdakrkae
    lneiakicskvsgegaksfyeacqlfwfihaiiniesnghsisparfdqymypyyendkn
    itdkfaqelidciwiklndinkvrdeistkhfggypmyqnlivggqnsegkdatnkvsym
    aleaavhvklpqpslsvriwnktpdefllraaeltreglglpayyndeviipalvsrglt
    ledardygiigcvepqkpgktegwhdsaffnlariveltinsgfdknkqigpktqnfeem
    ksfdefmkaykaqmeyfvkhmccadncidiahaeraplpflssmvdncigkgkslqdgga
    eynfsgpqgvgvanigdslvavkkivfdenkitpselkktlnndfknseeiqallknapk
    fgndidevdnlaregalvycrevnkytnprggnfqpglypssinvyfgsltgatpdgrks
    gqpladgvspsrgcdvsgptaacnsvskldhfiasngtlfnqkfhpsalkgdnglmnlss
    lirsyfdqkgfhvqfnvidkkillaaqknpekyqdlivrvagysaqfisldksiqndiia
    rtehvm