Lineage for d1r8ye_ (1r8y E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129396Family c.66.1.5: Glycine N-methyltransferase [53348] (1 protein)
  6. 2129397Protein Glycine N-methyltransferase [53349] (3 species)
  7. 2129403Species Mouse (Mus musculus) [TaxId:10090] [110665] (2 PDB entries)
    Uniprot Q9QXF8
  8. 2129410Domain d1r8ye_: 1r8y E: [104861]
    complexed with bme

Details for d1r8ye_

PDB Entry: 1r8y (more details), 3 Å

PDB Description: crystal structure of mouse glycine n-methyltransferase (monoclinic form)
PDB Compounds: (E:) glycine n-methyltransferase

SCOPe Domain Sequences for d1r8ye_:

Sequence, based on SEQRES records: (download)

>d1r8ye_ c.66.1.5 (E:) Glycine N-methyltransferase {Mouse (Mus musculus) [TaxId: 10090]}
vdsvyrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
ldvacgtgvdsimlveegfsvmsvdasdkmlkyalkerwnrrkepsfdnwvieeanwltl
dkdvlsgdgfdaviclgnsfahlpdckgdqsehrlalkniasmvrpggllvidhrnydyi
lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgtgrdgspgfskfrl
syyphclasftelvraafggrcqhsvlgdfkpykpgqayvpcyfihvlkktd

Sequence, based on observed residues (ATOM records): (download)

>d1r8ye_ c.66.1.5 (E:) Glycine N-methyltransferase {Mouse (Mus musculus) [TaxId: 10090]}
vdsvyrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
ldvacgtgvdsimlveegfsvmsvdasdkmlkyalkerwnrrkepsfdnwvieeanwltl
dkdvlsgdgfdaviclgnsfahlpdckgdqsehrlalkniasmvrpggllvidhrnydyi
lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgtgfskfrlsyyphc
lasftelvraafggrcqhsvlgdfkpykpgqayvpcyfihvlkktd

SCOPe Domain Coordinates for d1r8ye_:

Click to download the PDB-style file with coordinates for d1r8ye_.
(The format of our PDB-style files is described here.)

Timeline for d1r8ye_: