PDB entry 1r8y

View 1r8y on RCSB PDB site
Description: Crystal Structure of Mouse Glycine N-Methyltransferase (Monoclinic Form)
Class: transferase
Keywords: Glycine N-Methyltransferase, TRANSFERASE
Deposited on 2003-10-28, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycine n-methyltransferase
    Species: Mus musculus [TaxId:10090]
    Gene: GNMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r8ya_
  • Chain 'B':
    Compound: glycine n-methyltransferase
    Species: Mus musculus [TaxId:10090]
    Gene: GNMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r8yb_
  • Chain 'C':
    Compound: glycine n-methyltransferase
    Species: Mus musculus [TaxId:10090]
    Gene: GNMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r8yc_
  • Chain 'D':
    Compound: glycine n-methyltransferase
    Species: Mus musculus [TaxId:10090]
    Gene: GNMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r8yd_
  • Chain 'E':
    Compound: glycine n-methyltransferase
    Species: Mus musculus [TaxId:10090]
    Gene: GNMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r8ye_
  • Chain 'F':
    Compound: glycine n-methyltransferase
    Species: Mus musculus [TaxId:10090]
    Gene: GNMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r8yf_
  • Chain 'G':
    Compound: glycine n-methyltransferase
    Species: Mus musculus [TaxId:10090]
    Gene: GNMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r8yg_
  • Chain 'H':
    Compound: glycine n-methyltransferase
    Species: Mus musculus [TaxId:10090]
    Gene: GNMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r8yh_
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r8yA (A:)
    vdsvyrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvmsvdasdkmlkyalkerwnrrkepsfdnwvieeanwltl
    dkdvlsgdgfdaviclgnsfahlpdckgdqsehrlalkniasmvrpggllvidhrnydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgtgrdgspgfskfrl
    syyphclasftelvraafggrcqhsvlgdfkpykpgqayvpcyfihvlkktd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r8yA (A:)
    vdsvyrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvmsvdasdkmlkyalkerwnrrkepsfdnwvieeanwltl
    dkdvlsgdgfdaviclgnsfahlpdckgdqsehrlalkniasmvrpggllvidhrnydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqfskfrlsyyphclasft
    elvraafggrcqhsvlgdfkpykpgqayvpcyfihvlkktd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r8yB (B:)
    vdsvyrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvmsvdasdkmlkyalkerwnrrkepsfdnwvieeanwltl
    dkdvlsgdgfdaviclgnsfahlpdckgdqsehrlalkniasmvrpggllvidhrnydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgtgrdgspgfskfrl
    syyphclasftelvraafggrcqhsvlgdfkpykpgqayvpcyfihvlkktd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r8yB (B:)
    vdsvyrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvmsvdasdkmlkyalkerwnrrkepsfdnwvieeanwltl
    dkdvlsgdgfdaviclgnsfahlpdckgdqsehrlalkniasmvrpggllvidhrnydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvfskfrlsyyphclasf
    telvraafggrcqhsvlgdfkpykpgqayvpcyfihvlkktd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1r8yC (C:)
    vdsvyrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvmsvdasdkmlkyalkerwnrrkepsfdnwvieeanwltl
    dkdvlsgdgfdaviclgnsfahlpdckgdqsehrlalkniasmvrpggllvidhrnydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgtgrdgspgfskfrl
    syyphclasftelvraafggrcqhsvlgdfkpykpgqayvpcyfihvlkktd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r8yC (C:)
    vdsvyrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvmsvdasdkmlkyalkerwnrrkepsfdnwvieeanwltl
    dkdvlsgdgfdaviclgnsfahlpdckgdqsehrlalkniasmvrpggllvidhrnydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgtfskfrlsyyphcl
    asftelvraafggrcqhsvlgdfkpykpgqayvpcyfihvlkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1r8yD (D:)
    vdsvyrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvmsvdasdkmlkyalkerwnrrkepsfdnwvieeanwltl
    dkdvlsgdgfdaviclgnsfahlpdckgdqsehrlalkniasmvrpggllvidhrnydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgtgrdgspgfskfrl
    syyphclasftelvraafggrcqhsvlgdfkpykpgqayvpcyfihvlkktd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r8yD (D:)
    vdsvyrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvmsvdasdkmlkyalkerwnrrkepsfdnwvieeanwltl
    dkdvlsgdgfdaviclgnsfahlpdckgdqsehrlalkniasmvrpggllvidhrnydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpspgfskfrlsyyphc
    lasftelvraafggrcqhsvlgdfkpykpgqayvpcyfihvlkktd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1r8yE (E:)
    vdsvyrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvmsvdasdkmlkyalkerwnrrkepsfdnwvieeanwltl
    dkdvlsgdgfdaviclgnsfahlpdckgdqsehrlalkniasmvrpggllvidhrnydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgtgrdgspgfskfrl
    syyphclasftelvraafggrcqhsvlgdfkpykpgqayvpcyfihvlkktd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r8yE (E:)
    vdsvyrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvmsvdasdkmlkyalkerwnrrkepsfdnwvieeanwltl
    dkdvlsgdgfdaviclgnsfahlpdckgdqsehrlalkniasmvrpggllvidhrnydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgtgfskfrlsyyphc
    lasftelvraafggrcqhsvlgdfkpykpgqayvpcyfihvlkktd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1r8yF (F:)
    vdsvyrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvmsvdasdkmlkyalkerwnrrkepsfdnwvieeanwltl
    dkdvlsgdgfdaviclgnsfahlpdckgdqsehrlalkniasmvrpggllvidhrnydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgtgrdgspgfskfrl
    syyphclasftelvraafggrcqhsvlgdfkpykpgqayvpcyfihvlkktd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r8yF (F:)
    vdsvyrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvmsvdasdkmlkyalkerwnrrkepsfdnwvieeanwltl
    dkdvlsgdgfdaviclgnsfahlpdckgdqsehrlalkniasmvrpggllvidhrnydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvgfskfrlsyyphclas
    ftelvraafggrcqhsvlgdfkpykpgqayvpcyfihvlkkt
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1r8yG (G:)
    vdsvyrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvmsvdasdkmlkyalkerwnrrkepsfdnwvieeanwltl
    dkdvlsgdgfdaviclgnsfahlpdckgdqsehrlalkniasmvrpggllvidhrnydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgtgrdgspgfskfrl
    syyphclasftelvraafggrcqhsvlgdfkpykpgqayvpcyfihvlkktd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r8yG (G:)
    vdsvyrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvmsvdasdkmlkyalkerwnrrkepsfdnwvieeanwltl
    dkdvlsgdgfdaviclgnsfahlpdckgdqsehrlalkniasmvrpggllvidhrnydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvgfskfrlsyyphclas
    ftelvraafggrcqhsvlgdfkpykpgqayvpcyfihvlkktd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1r8yH (H:)
    vdsvyrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvmsvdasdkmlkyalkerwnrrkepsfdnwvieeanwltl
    dkdvlsgdgfdaviclgnsfahlpdckgdqsehrlalkniasmvrpggllvidhrnydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgtgrdgspgfskfrl
    syyphclasftelvraafggrcqhsvlgdfkpykpgqayvpcyfihvlkktd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r8yH (H:)
    vdsvyrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvmsvdasdkmlkyalkerwnrrkepsfdnwvieeanwltl
    dkdvlsgdgfdaviclgnsfahlpdckgdqsehrlalkniasmvrpggllvidhrnydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvfskfrlsyyphclasf
    telvraafggrcqhsvlgdfkpykpgqayvpcyfihvlkktd