| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) ![]() |
| Family c.66.1.25: mRNA cap methylase [88785] (3 proteins) |
| Protein An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 [89741] (2 species) structurally and functionally similar to VP39 |
| Species Flavivirus (Dengue virus type 2) [TaxId:12637] [89742] (8 PDB entries) Uniprot P12823 2495-2756 |
| Domain d1r6aa_: 1r6a A: [104817] complexed with rvp, sah, so4 |
PDB Entry: 1r6a (more details), 2.6 Å
SCOPe Domain Sequences for d1r6aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r6aa_ c.66.1.25 (A:) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Flavivirus (Dengue virus type 2) [TaxId: 12637]}
etlgekwksrlnalgksefqiykksgiqevdrtlakegikrgetdhhavsrgsaklrwfv
ernlvtpegkvvdlgcgrggwsyycgglknvrevkgltkggpgheepipmstygwnlvrl
qsgvdvffippercdtllcdigesspnptveagrtlrvlnlvenwlsnntqfcvkvlnpy
mpsviekmealqrkhggalvrnplsrnsthemywvsnasgnivssvnmisrmlinrftmr
hkkatyepdvdlgsgtrnigie
Timeline for d1r6aa_: