Lineage for d1r6aa_ (1r6a A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 490261Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 490262Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (39 families) (S)
  5. 490561Family c.66.1.25: mRNA cap methylase [88785] (2 proteins)
  6. 490562Protein An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 [89741] (1 species)
    structurally and functionally similar to VP39
  7. 490563Species Flavivirus (Dengue virus type 2) [TaxId:12637] [89742] (2 PDB entries)
  8. 490565Domain d1r6aa_: 1r6a A: [104817]

Details for d1r6aa_

PDB Entry: 1r6a (more details), 2.6 Å

PDB Description: Structure of the dengue virus 2'O methyltransferase in complex with s-adenosyl homocysteine and ribavirin 5' triphosphate

SCOP Domain Sequences for d1r6aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r6aa_ c.66.1.25 (A:) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Flavivirus (Dengue virus type 2)}
etlgekwksrlnalgksefqiykksgiqevdrtlakegikrgetdhhavsrgsaklrwfv
ernlvtpegkvvdlgcgrggwsyycgglknvrevkgltkggpgheepipmstygwnlvrl
qsgvdvffippercdtllcdigesspnptveagrtlrvlnlvenwlsnntqfcvkvlnpy
mpsviekmealqrkhggalvrnplsrnsthemywvsnasgnivssvnmisrmlinrftmr
hkkatyepdvdlgsgtrnigie

SCOP Domain Coordinates for d1r6aa_:

Click to download the PDB-style file with coordinates for d1r6aa_.
(The format of our PDB-style files is described here.)

Timeline for d1r6aa_: