Lineage for d1r4cg_ (1r4c G:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1196747Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1196748Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 1196781Family d.17.1.2: Cystatins [54407] (7 proteins)
  6. 1196815Protein Cystatin C [64231] (1 species)
  7. 1196816Species Human (Homo sapiens) [TaxId:9606] [64232] (8 PDB entries)
    Uniprot P01034 37-146
  8. 1196828Domain d1r4cg_: 1r4c G: [104799]
    dimeric form with segment-swapping

Details for d1r4cg_

PDB Entry: 1r4c (more details), 2.18 Å

PDB Description: n-truncated human cystatin c; dimeric form with 3d domain swapping
PDB Compounds: (G:) Cystatin C

SCOPe Domain Sequences for d1r4cg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4cg_ d.17.1.2 (G:) Cystatin C {Human (Homo sapiens) [TaxId: 9606]}
ggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagvnyfldvelgr
ttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda

SCOPe Domain Coordinates for d1r4cg_:

Click to download the PDB-style file with coordinates for d1r4cg_.
(The format of our PDB-style files is described here.)

Timeline for d1r4cg_: