SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1r4cg_ (1r4c G:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2161468Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2161469Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2161502Family d.17.1.2: Cystatins [54407] (7 protein domains)
    automatically mapped to Pfam PF00031
  6. 2161536Protein Cystatin C [64231] (1 species)
  7. 2161537Species Human (Homo sapiens) [TaxId:9606] [64232] (9 PDB entries)
    Uniprot P01034 37-146
  8. 2161549Domain d1r4cg_: 1r4c G: [104799]
    dimeric form with segment-swapping

Details for d1r4cg_

PDB Entry: 1r4c (more details), 2.18 Å

PDB Description: N-Truncated Human Cystatin C; Dimeric Form With 3D Domain Swapping
PDB Compounds: (G:) Cystatin C

SCOPe Domain Sequences for d1r4cg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4cg_ d.17.1.2 (G:) Cystatin C {Human (Homo sapiens) [TaxId: 9606]}
ggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagvnyfldvelgr
ttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda

SCOPe Domain Coordinates for d1r4cg_:

Click to download the PDB-style file with coordinates for d1r4cg_.
(The format of our PDB-style files is described here.)

Timeline for d1r4cg_: