Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta |
Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families) zinc-binding motif |
Family d.65.1.4: VanX-like [111022] (1 protein) Pfam PF01427 |
Protein D-Ala-D-Ala dipeptidase VanX [111023] (1 species) |
Species Enterococcus faecium [TaxId:1352] [111024] (1 PDB entry) Uniprot Q06241 |
Domain d1r44c_: 1r44 C: [104789] complexed with zn |
PDB Entry: 1r44 (more details), 2.25 Å
SCOPe Domain Sequences for d1r44c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r44c_ d.65.1.4 (C:) D-Ala-D-Ala dipeptidase VanX {Enterococcus faecium [TaxId: 1352]} meigftfldeivhgvrwdakyatwdnftgkpvdgyevnrivgtyelaesllkakelaatq gyglllwdgyrpkravncfmqwaaqpennltkesyypnidrtemiskgyvasksshsrgs aidltlyrldtgelvpmgsrfdfmdershhaangiscneaqnrrrlrsimensgfeaysl ewwhyvlrdepypnsyfdfpvk
Timeline for d1r44c_: