PDB entry 1r44

View 1r44 on RCSB PDB site
Description: Crystal Structure of VanX
Class: hydrolase
Keywords: VanX, E.faecium, dipeptidase, HYDROLASE
Deposited on 2003-10-03, released 2004-06-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-alanyl-D-alanine dipeptidase
    Species: Enterococcus faecium [TaxId:1352]
    Gene: VANX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r44a_
  • Chain 'B':
    Compound: D-alanyl-D-alanine dipeptidase
    Species: Enterococcus faecium [TaxId:1352]
    Gene: VANX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r44b_
  • Chain 'C':
    Compound: D-alanyl-D-alanine dipeptidase
    Species: Enterococcus faecium [TaxId:1352]
    Gene: VANX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r44c_
  • Chain 'D':
    Compound: D-alanyl-D-alanine dipeptidase
    Species: Enterococcus faecium [TaxId:1352]
    Gene: VANX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r44d_
  • Chain 'E':
    Compound: D-alanyl-D-alanine dipeptidase
    Species: Enterococcus faecium [TaxId:1352]
    Gene: VANX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r44e_
  • Chain 'F':
    Compound: D-alanyl-D-alanine dipeptidase
    Species: Enterococcus faecium [TaxId:1352]
    Gene: VANX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r44f_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r44A (A:)
    meigftfldeivhgvrwdakyatwdnftgkpvdgyevnrivgtyelaesllkakelaatq
    gyglllwdgyrpkravncfmqwaaqpennltkesyypnidrtemiskgyvasksshsrgs
    aidltlyrldtgelvpmgsrfdfmdershhaangiscneaqnrrrlrsimensgfeaysl
    ewwhyvlrdepypnsyfdfpvk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r44B (B:)
    meigftfldeivhgvrwdakyatwdnftgkpvdgyevnrivgtyelaesllkakelaatq
    gyglllwdgyrpkravncfmqwaaqpennltkesyypnidrtemiskgyvasksshsrgs
    aidltlyrldtgelvpmgsrfdfmdershhaangiscneaqnrrrlrsimensgfeaysl
    ewwhyvlrdepypnsyfdfpvk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r44C (C:)
    meigftfldeivhgvrwdakyatwdnftgkpvdgyevnrivgtyelaesllkakelaatq
    gyglllwdgyrpkravncfmqwaaqpennltkesyypnidrtemiskgyvasksshsrgs
    aidltlyrldtgelvpmgsrfdfmdershhaangiscneaqnrrrlrsimensgfeaysl
    ewwhyvlrdepypnsyfdfpvk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r44D (D:)
    meigftfldeivhgvrwdakyatwdnftgkpvdgyevnrivgtyelaesllkakelaatq
    gyglllwdgyrpkravncfmqwaaqpennltkesyypnidrtemiskgyvasksshsrgs
    aidltlyrldtgelvpmgsrfdfmdershhaangiscneaqnrrrlrsimensgfeaysl
    ewwhyvlrdepypnsyfdfpvk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r44E (E:)
    meigftfldeivhgvrwdakyatwdnftgkpvdgyevnrivgtyelaesllkakelaatq
    gyglllwdgyrpkravncfmqwaaqpennltkesyypnidrtemiskgyvasksshsrgs
    aidltlyrldtgelvpmgsrfdfmdershhaangiscneaqnrrrlrsimensgfeaysl
    ewwhyvlrdepypnsyfdfpvk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r44F (F:)
    meigftfldeivhgvrwdakyatwdnftgkpvdgyevnrivgtyelaesllkakelaatq
    gyglllwdgyrpkravncfmqwaaqpennltkesyypnidrtemiskgyvasksshsrgs
    aidltlyrldtgelvpmgsrfdfmdershhaangiscneaqnrrrlrsimensgfeaysl
    ewwhyvlrdepypnsyfdfpvk