Lineage for d1r44f_ (1r44 F:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families) (S)
    zinc-binding motif
  5. Family d.65.1.4: VanX-like [111022] (1 protein)
    Pfam PF01427
  6. Protein D-Ala-D-Ala dipeptidase VanX [111023] (1 species)
  7. Species Enterococcus faecium [TaxId:1352] [111024] (1 PDB entry)
    Uniprot Q06241
  8. Domain d1r44f_: 1r44 F: [104792]
    complexed with zn

Details for d1r44f_

PDB Entry: 1r44 (more details), 2.25 Å

PDB Description: crystal structure of vanx
PDB Compounds: (F:) D-alanyl-D-alanine dipeptidase

SCOPe Domain Sequences for d1r44f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r44f_ d.65.1.4 (F:) D-Ala-D-Ala dipeptidase VanX {Enterococcus faecium [TaxId: 1352]}
meigftfldeivhgvrwdakyatwdnftgkpvdgyevnrivgtyelaesllkakelaatq
gyglllwdgyrpkravncfmqwaaqpennltkesyypnidrtemiskgyvasksshsrgs
aidltlyrldtgelvpmgsrfdfmdershhaangiscneaqnrrrlrsimensgfeaysl
ewwhyvlrdepypnsyfdfpvk

SCOPe Domain Coordinates for d1r44f_ are not available.

Timeline for d1r44f_:

Domains from other chains:
(mouse over for more information)
d1r44a_, d1r44b_, d1r44c_, d1r44d_, d1r44e_