Class a: All alpha proteins [46456] (218 folds) |
Fold a.216: I/LWEQ domain (Pfam 01608) [109884] (1 superfamily) 5 helices; bundle, closed, left-handed twist |
Superfamily a.216.1: I/LWEQ domain (Pfam 01608) [109885] (1 family) |
Family a.216.1.1: I/LWEQ domain (Pfam 01608) [109886] (2 proteins) actin-binding motif that adopts different folds; possibly refolds upon binding |
Protein Huntingtin interacting protein 12 [109887] (1 species) Hip1r thatch domain core |
Species Human (Homo sapiens) [TaxId:9606] [109888] (1 PDB entry) |
Domain d1r0df_: 1r0d F: [104719] |
PDB Entry: 1r0d (more details), 1.9 Å
SCOP Domain Sequences for d1r0df_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r0df_ a.216.1.1 (F:) Huntingtin interacting protein 12 {Human (Homo sapiens)} dvrqeelgavvdkemaatsaaiedavrriedmmnqarhassgvklevnerilnsctdlmk airllvttstslqkeivesgrgaatqqefyaknsrwteglisaskavgwgatqlveaadk vvlhtgkyeelivcsheiaastaqlvaaskvkankhsphlsrlqecsrtvneraanvvas tksgqeqied
Timeline for d1r0df_: