SCOP 1.69: Domain d1r0db_: 1r0d B:

Lineage for d1r0db_ (1r0d B:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.216: I/LWEQ domain (Pfam 01608) [109884] (1 superfamily)
   5 helices; bundle, closed, left-handed twist

4. Superfamily a.216.1: I/LWEQ domain (Pfam 01608) [109885] (1 family)

5. Family a.216.1.1: I/LWEQ domain (Pfam 01608) [109886] (2 proteins)
   actin-binding motif that adopts different folds; possibly refolds upon binding

6. Protein Huntingtin interacting protein 12 [109887] (1 species)
   Hip1r thatch domain core

7. Species Human (Homo sapiens) [TaxId:9606] [109888] (1 PDB entry)

8. Domain d1r0db_: 1r0d B: [104716]

Details for d1r0db_

PDB Entry: 1r0d, 1.9 Å

PDB Description: hip1r thatch domain core

SCOP Domain Sequences for d1r0db_:

Sequence; same for both SEQRES and ATOM records:

>d1r0db_ a.216.1.1 (B:) Huntingtin interacting protein 12 {Human (Homo sapiens)}
dvrqeelgavvdkemaatsaaiedavrriedmmnqarhassgvklevnerilnsctdlmk
airllvttstslqkeivesgrgaatqqefyaknsrwteglisaskavgwgatqlveaadk
vvlhtgkyeelivcsheiaastaqlvaaskvkankhsphlsrlqecsrtvneraanvvas
tksgqeqied

Timeline for d1r0db_:

• d1r0db_ is new in SCOP 1.69
  
• d1r0db_ appears in SCOP 1.71
  
• d1r0db_ appears in the current release, SCOPe 2.08