Lineage for d1qx4a1 (1qx4 A:33-153)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464636Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 464757Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 464779Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (8 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 464784Protein cytochrome b5 reductase [50427] (2 species)
  7. 464787Species Rat (Rattus norvegicus) [TaxId:10116] [69273] (3 PDB entries)
  8. 464788Domain d1qx4a1: 1qx4 A:33-153 [104624]
    Other proteins in same PDB: d1qx4a2, d1qx4b2

Details for d1qx4a1

PDB Entry: 1qx4 (more details), 1.8 Å

PDB Description: structrue of s127p mutant of cytochrome b5 reductase

SCOP Domain Sequences for d1qx4a1:

Sequence, based on SEQRES records: (download)

>d1qx4a1 b.43.4.2 (A:33-153) cytochrome b5 reductase {Rat (Rattus norvegicus)}
itlenpdikyplrlidkeilshdtrrfrfalpspqhilglpigqhiylstridgnlvirp
ytpvssdddkgfvdlvvkvyfkethpkfpaggkmpqylenmnigdtiefrgpngllvyqg
k

Sequence, based on observed residues (ATOM records): (download)

>d1qx4a1 b.43.4.2 (A:33-153) cytochrome b5 reductase {Rat (Rattus norvegicus)}
itlenpdikyplrlidkeilshdtrrfrfalpspqhilglpigqhiylstridgnlvirp
ytpvssdddkgfvdlvvkvyfkeaggkmpqylenmnigdtiefrgpngllvyqgk

SCOP Domain Coordinates for d1qx4a1:

Click to download the PDB-style file with coordinates for d1qx4a1.
(The format of our PDB-style files is described here.)

Timeline for d1qx4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qx4a2